Improve loading speed of thumbnail and full images in HTML

I'm struggling with slow loading images on my blog website. Can anyone help me figure out how to improve loading speed and:

  • Is it possible to use a separate thumbnail image that is smaller in size instead of the full image for both thumbnails and the main story? If so, how can I implement this?
  • What is the best location to store images for websites and blogs? Can I save them on OneDrive and use that as the image source?
  • How can I optimize images and what is a placeholder? I've noticed some websites like Facebook use a placeholder that shows up before the actual image loads - how can I do something similar? - Is there a way to preload images or improve image loading in a different manner?
javascriptjqueryhtmlcssmysql

Answer №1

Here are a few crucial tips.

  • Make sure to keep thumbnail images separate from the original large ones. Utilize a script to resize images when they are uploaded by users. If you are using a common CMS like Joomla or Magento, there should be an option available for resizing without requiring any coding on your part.
  • If your blog is open to the public, ensure that the images are also accessible to everyone. Create a directory named media and store all images in it. Most standard CMS platforms have these options integrated into their systems.
    • To prevent clutter in one directory in the long term, organize your files under different folders such as media/[YEAR]/[MONTH] or any other organizational structure that suits your needs.
    • Secure the uploads directory and upload process with proper protocols like using an .htaccess file (or equivalent). This will prevent malicious scripts from being uploaded and executed on your server.
  • A placeholder is essentially a stand-in for content when the original content is not yet loaded or absent. For example, a placeholder image can be a generic loading symbol. You can use JavaScript or CSS (background-image) to create such a placeholder.
    • Preloading may not be required based on your question. Sharing a link to your website could help provide more precise advice or suggestions.

In future inquiries, try to ask specific questions - one question per issue, if feasible. Don't hesitate to search for solutions online. I personally learned various programming languages such as Python, Ruby, and Laravel simply by researching on the web! Hope this information proves useful!

Answer №2

Jigar did a commendable job answering the question, but I have some additional information to share. If you're looking to optimize images, there are numerous websites available that offer this service for free.

My personal favorite is , although there are many others to choose from. A simple Google search will provide you with various options that all serve the same purpose.

This particular post may also provide some insight: Load a low-res background image first, then a high-res one

Similar questions

If you have not found the answer to your question or you are interested in this topic, then look at other similar questions below or use the search

Boosting the specificity of Material UI override styles

I came across a question about Material UI Overriding styles with increased specificity that seemed related to my issue, but I couldn't apply the solution to my problem. My problem involves a vertical Slider with marks, and I am trying to remove the ...

cssreactjsmaterial-ui

Obtaining Data from PHP using jQuery AJAX

Currently utilizing the ajax function in Jquery to retrieve values from a PHP script using the json_encode function. However, the data being returned is riddled with slashes, quotes, and \r\n. It appears that there may be an issue with stripslash ...

phpjqueryajax

It appears that Vivus JS is having difficulty animating specific <path> elements

I've been experimenting with the Vivus JS library, which is fantastic for animating paths such as drawing an image. However, I'm facing an issue where my SVG icon should animate to a 100% line-width, but it's not working as expected. Interes ...

javascriptanimationsvgsvg-pathvivus

Retrieve information from an HTML form

Currently, I have a piece of Javascript that fetches the HTML for a form from the server using an XMLHttpRequest and then displays the form on the page. I am looking for a solution to extract the data that would be sent via POST if the form were submitted ...

javascripthtmlajaxformsxmlhttprequest

Dynamic header that adjusts to fit window size fluctuations

I'm currently working on a website and trying to make it responsive by adjusting to changes in the browser window size. I'm having trouble changing the header height based on the window size unlike how it works for my pictures in CSS: #l ...

javascriptjqueryhtmlcssresize

Show inline-block elements within a div that has a variable width, allowing for horizontal scrolling

Currently, my layout is as follows: https://jsfiddle.net/0r6cdwht/2/ Is there a way to enable horizontal scrolling when the items displayed inside the div overflow? I've done some research and came across a solution that suggested using white-spac ...

htmlcss

Error sending an email through the EmailJS backend JavaScript file

I am in the process of creating a route for my backend JavaScript Express server called server.js that will trigger an email to be sent to my Gmail account using EmailJS. When I attempt to use the following code: const SMTPClient = require("emailjs& ...

javascriptreactjsnode.jsemail

Scraping data from a support portal using JSOUP

I am currently learning how to utilize jSoup for web scraping purposes on this specific portal that focuses on LAN switching and routing discussions. Link to the portal My goal is to extract information from a list of topics, specifically identifying sol ...

javahtmlweb-scrapingjsoupwebsphere-portal

The objects-to-csv module encountered an error: fs.existsSync is not a valid function for this

"TypeError: fs.existsSync is not a function" Whenever I try to create a CSV file and input some data into it, this error message pops up. const objectstocsv = require('objects-to-csv'); export default { data () { return { ...

javascriptnode.jsvue.jscsv

Optimal method for Python to engage with MySQL databases

As a beginner in programming, I am currently teaching myself the correct ways of coding. My current project involves writing a script in Python that will receive 1-3 values every second and save them to a MySQL database. Eventually, I plan on creating a we ...

pythonmysqljsonhttpget

What is the reason for restricting AJAX requests to the same domain?

I'm puzzled by the limitation of AJAX requests to the same domain. Can you explain the reasoning behind this restriction? I don't understand why requesting files from external locations is an issue, especially since servers making XMLHTTP reques ...

javascriptajaxxsssame-origin-policy

Shadows persist despite light intensity being reduced to 0 during runtime

Struggling to figure out how to get rid of these persistent shadows... During runtime, I attempt: light.intensity = 0.0; This makes the scene darker (which is good), but the shadows created by the light remain visible. I've experimented with both ...

javascriptthree.js

What is preventing the bundling of my CSS into the application?

I'm facing an issue while setting up a new project using vue.js, scss, and webpack (with express.js on the server side and TypeScript). I copied over the configurations from a previous project where everything was working fine. According to my underst ...

javascriptnode.jsvue.jswebpacksass

Leveraging the power of jQuery with AJAX operations

In my collection of PHP files, I have three named: index page books user Index Page <link href="colorbox.css" type="text/css" rel="stylesheet" media="all" /> <script type="text/javascript" src="jquery-1.8.2.min.js"></script> <scrip ...

phpjqueryajax

Utilize jQuery to broadcast messages containing textarea content to all users from the database via email

Currently, I am facing an issue while trying to send an email to all users from the database using the value from a textarea. It seems like there is an error in my approach. Upon further inspection, I suspect that the problem lies in selecting the data fro ...

jquerymysqlajaxdatabaseemail

Remove the right margin on the bootstrap container

I am currently working on creating dashboards using the Python library called Dash, and I have encountered an issue with Bootstrap components. Specifically, I am unable to remove the right margin from the container. I have tried using class_name='m-0& ...

pythoncsstwitter-bootstrapplotly-dashbootstrap-5

What is the best way to transform a List<Pair<String, String>> to a List<String> using JavaScript?

Here is the data output structure: Map<String, List<Pair<String, String>>> "testdata": [ { "1.0": "True" }, { "1.1": "False" } ] ...

javascriptvue.js

Accents marked with diacritics are not being detected + An issue occurred while

I'm currently working on putting together a Spanish dictionary by sourcing the definitions from www.rae.es. However, there are a couple of challenges I'm facing: One issue is that the search engine does not function properly with acute accent ...

phpjavascripthtmlhyperlinkhtml-parsing

How to sort objects by keys in AngularJS

Currently, I am working on building a sorting list using AngularJS. The goal is to have the data updated in the DOM dynamically when a user clicks on the name of a value. I am attempting to order the values by categories such as Bracelets, Charms, Earrings ...

javascriptarraysjsonangularjs

AngularJS modal popup with a selectable table

Is there a way to open a modal popup containing a table in my application? I'm trying to achieve this by setting up an event in my app.js that triggers the modal when a row is clicked. Additionally, I need to update a field with the selected item&apos ...

javascriptangularjsangular-ui-bootstrap